SCOPe 2.06: Domain d2nu4i_: 2nu4 I:

Lineage for d2nu4i_ (2nu4 I:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (36 PDB entries)

8. Domain d2nu4i_: 2nu4 I: [138603]
   Other proteins in same PDB: d2nu4e_
   automated match to d1hjai_

Details for d2nu4i_

PDB Entry: 2nu4, 1.75 Å

PDB Description: accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i

PDB Compounds: (I:) Ovomucoid

SCOPe Domain Sequences for d2nu4i_:

Sequence; same for both SEQRES and ATOM records:

>d2nu4i_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactkeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Timeline for d2nu4i_:

• d2nu4i_ first appeared in SCOP 1.73, called d2nu4i1
  
• d2nu4i_ appears in SCOPe 2.05
  
• d2nu4i_ appears in SCOPe 2.07
  
• d2nu4i_ appears in the current release, SCOPe 2.08