SCOP 1.73: Domain d2nu4i1: 2nu4 I:6-56

Lineage for d2nu4i1 (2nu4 I:6-56)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (35 PDB entries)

8. Domain d2nu4i1: 2nu4 I:6-56 [138603]
   Other proteins in same PDB: d2nu4e1
   automatically matched to d1hjai_
   mutant

Details for d2nu4i1

PDB Entry: 2nu4, 1.75 Å

PDB Description: accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i

PDB Compounds: (I:) Ovomucoid

SCOP Domain Sequences for d2nu4i1:

Sequence; same for both SEQRES and ATOM records:

>d2nu4i1 g.68.1.1 (I:6-56) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactkeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Timeline for d2nu4i1:

• d2nu4i1 is new in SCOP 1.73
  
• d2nu4i1 appears in SCOP 1.75
  
• d2nu4i1 appears in the current release, SCOPe 2.08, called d2nu4i_