Lineage for d2nu2e_ (2nu2 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794786Protein automated matches [190306] (9 species)
    not a true protein
  7. 2794847Species Streptomyces griseus [TaxId:1911] [187119] (8 PDB entries)
  8. 2794851Domain d2nu2e_: 2nu2 E: [138599]
    Other proteins in same PDB: d2nu2i1
    automated match to d1sgde_

Details for d2nu2e_

PDB Entry: 2nu2 (more details), 1.65 Å

PDB Description: accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
PDB Compounds: (E:) Streptogrisin B, Protease B

SCOPe Domain Sequences for d2nu2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu2e_ b.47.1.1 (E:) automated matches {Streptomyces griseus [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

SCOPe Domain Coordinates for d2nu2e_:

Click to download the PDB-style file with coordinates for d2nu2e_.
(The format of our PDB-style files is described here.)

Timeline for d2nu2e_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nu2i1