Lineage for d2ntmb_ (2ntm B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2602753Superfamily d.153.2: Archaeal IMP cyclohydrolase PurO [75569] (1 family) (S)
    has a putative active site in the same topological location as the Ntn hydrolase but lacks the N-terminal nucleophile
    automatically mapped to Pfam PF07826
  5. 2602754Family d.153.2.1: Archaeal IMP cyclohydrolase PurO [75570] (1 protein)
    Pfam PF07826
  6. 2602755Protein Hypothetical protein MTH1020 [75571] (1 species)
  7. 2602756Species Methanothermobacter thermautotrophicus [TaxId:145262] [75572] (4 PDB entries)
  8. 2602767Domain d2ntmb_: 2ntm B: [138592]
    Other proteins in same PDB: d2ntmd3

Details for d2ntmb_

PDB Entry: 2ntm (more details), 2.6 Å

PDB Description: Crystal structure of PurO from Methanothermobacter thermoautotrophicus
PDB Compounds: (B:) IMP cyclohydrolase

SCOPe Domain Sequences for d2ntmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntmb_ d.153.2.1 (B:) Hypothetical protein MTH1020 {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mylgrilavgrnsngsfvayrvssrsfpnrttsiqeervavvpvegherdvfrnpyiayn
cirivgdtavvsngshtdtiadkvalgmnlrdaiglsllamdyekdelntpriaaaings
eafigivtadglmvsrvpeetpvyistyeqtepaatefkagspeeaaefilkggefaaft
hpvtaaaafndgegwnlatrem

SCOPe Domain Coordinates for d2ntmb_:

Click to download the PDB-style file with coordinates for d2ntmb_.
(The format of our PDB-style files is described here.)

Timeline for d2ntmb_: