![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.2: Archaeal IMP cyclohydrolase PurO [75569] (1 family) ![]() has a putative active site in the same topological location as the Ntn hydrolase but lacks the N-terminal nucleophile |
![]() | Family d.153.2.1: Archaeal IMP cyclohydrolase PurO [75570] (1 protein) Pfam PF07826 |
![]() | Protein Hypothetical protein MTH1020 [75571] (1 species) |
![]() | Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75572] (4 PDB entries) |
![]() | Domain d2ntmb1: 2ntm B:1-202 [138592] automatically matched to d1kuua_ |
PDB Entry: 2ntm (more details), 2.6 Å
SCOP Domain Sequences for d2ntmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntmb1 d.153.2.1 (B:1-202) Hypothetical protein MTH1020 {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} mylgrilavgrnsngsfvayrvssrsfpnrttsiqeervavvpvegherdvfrnpyiayn cirivgdtavvsngshtdtiadkvalgmnlrdaiglsllamdyekdelntpriaaaings eafigivtadglmvsrvpeetpvyistyeqtepaatefkagspeeaaefilkggefaaft hpvtaaaafndgegwnlatrem
Timeline for d2ntmb1: