SCOP 1.73: Domain d2ntmb1: 2ntm B:1-202

Lineage for d2ntmb1 (2ntm B:1-202)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.2: Archaeal IMP cyclohydrolase PurO [75569] (1 family)
   has a putative active site in the same topological location as the Ntn hydrolase but lacks the N-terminal nucleophile

5. Family d.153.2.1: Archaeal IMP cyclohydrolase PurO [75570] (1 protein)
   Pfam PF07826

6. Protein Hypothetical protein MTH1020 [75571] (1 species)

7. Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75572] (4 PDB entries)

8. Domain d2ntmb1: 2ntm B:1-202 [138592]
   automatically matched to d1kuua_

Details for d2ntmb1

PDB Entry: 2ntm, 2.6 Å

PDB Description: Crystal structure of PurO from Methanothermobacter thermoautotrophicus

PDB Compounds: (B:) IMP cyclohydrolase

SCOP Domain Sequences for d2ntmb1:

Sequence; same for both SEQRES and ATOM records:

>d2ntmb1 d.153.2.1 (B:1-202) Hypothetical protein MTH1020 {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]}
mylgrilavgrnsngsfvayrvssrsfpnrttsiqeervavvpvegherdvfrnpyiayn
cirivgdtavvsngshtdtiadkvalgmnlrdaiglsllamdyekdelntpriaaaings
eafigivtadglmvsrvpeetpvyistyeqtepaatefkagspeeaaefilkggefaaft
hpvtaaaafndgegwnlatrem

Timeline for d2ntmb1:

• d2ntmb1 is new in SCOP 1.73
  
• d2ntmb1 appears in SCOP 1.75
  
• d2ntmb1 appears in the current release, SCOPe 2.08, called d2ntmb_