SCOPe 2.08: Domain d2ntlc2: 2ntl C:1-202

Lineage for d2ntlc2 (2ntl C:1-202)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.2: Archaeal IMP cyclohydrolase PurO [75569] (1 family)
   has a putative active site in the same topological location as the Ntn hydrolase but lacks the N-terminal nucleophile
   automatically mapped to Pfam PF07826

5. Family d.153.2.1: Archaeal IMP cyclohydrolase PurO [75570] (1 protein)
   Pfam PF07826

6. Protein Hypothetical protein MTH1020 [75571] (1 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [75572] (4 PDB entries)

8. Domain d2ntlc2: 2ntl C:1-202 [138589]
   Other proteins in same PDB: d2ntlc3
   complexed with amz

Details for d2ntlc2

PDB Entry: 2ntl, 2.6 Å

PDB Description: Crystal structure of PurO/AICAR from Methanothermobacter thermoautotrophicus

PDB Compounds: (C:) IMP cyclohydrolase

SCOPe Domain Sequences for d2ntlc2:

Sequence; same for both SEQRES and ATOM records:

>d2ntlc2 d.153.2.1 (C:1-202) Hypothetical protein MTH1020 {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mylgrilavgrnsngsfvayrvssrsfpnrttsiqeervavvpvegherdvfrnpyiayn
cirivgdtavvsngshtdtiadkvalgmnlrdaiglsllamdyekdelntpriaaaings
eafigivtadglmvsrvpeetpvyistyeqtepaatefkagspeeaaefilkggefaaft
hpvtaaaafndgegwnlatrem

Timeline for d2ntlc2:

• d2ntlc2 first appeared in SCOP 1.73, called d2ntlc1
  
• d2ntlc2 appears in SCOPe 2.07