Lineage for d2ntjb1 (2ntj B:3-269)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686655Protein Enoyl-ACP reductase [51791] (6 species)
  7. 686727Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (19 PDB entries)
  8. 686737Domain d2ntjb1: 2ntj B:3-269 [138582]
    automatically matched to d1bvra_
    complexed with p1h; mutant

Details for d2ntjb1

PDB Entry: 2ntj (more details), 2.5 Å

PDB Description: Mycobacterium tuberculosis InhA bound with PTH-NAD adduct
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH

SCOP Domain Sequences for d2ntjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntjb1 c.2.1.2 (B:3-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
callsdwlpattgdiiyadggahtqll

SCOP Domain Coordinates for d2ntjb1:

Click to download the PDB-style file with coordinates for d2ntjb1.
(The format of our PDB-style files is described here.)

Timeline for d2ntjb1: