Lineage for d2ntha_ (2nth A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2172372Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2172378Protein Phage T4 lysozyme [53982] (1 species)
  7. 2172379Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2172641Domain d2ntha_: 2nth A: [138580]
    automated match to d212l__
    complexed with mtn; mutant

Details for d2ntha_

PDB Entry: 2nth (more details), 1.8 Å

PDB Description: structure of spin-labeled t4 lysozyme mutant l118r1
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2ntha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntha_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnscrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d2ntha_:

Click to download the PDB-style file with coordinates for d2ntha_.
(The format of our PDB-style files is described here.)

Timeline for d2ntha_: