SCOPe 2.05: Domain d2ntga_: 2ntg A:

Lineage for d2ntga_ (2ntg A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d2ntga_: 2ntg A: [138579]
   automated match to d2igca1
   complexed with bme, r7a; mutant

Details for d2ntga_

PDB Entry: 2ntg, 1.4 Å

PDB Description: structure of spin-labeled t4 lysozyme mutant t115r7

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2ntga_:

Sequence; same for both SEQRES and ATOM records:

>d2ntga_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d2ntga_:

• d2ntga_ first appeared in SCOP 1.73, called d2ntga1
  
• d2ntga_ appears in SCOPe 2.04
  
• d2ntga_ appears in SCOPe 2.06
  
• d2ntga_ appears in the current release, SCOPe 2.08