Lineage for d2ntga1 (2ntg A:1-164)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850692Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 850698Protein Phage T4 lysozyme [53982] (1 species)
  7. 850699Species Bacteriophage T4 [TaxId:10665] [53983] (446 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 850706Domain d2ntga1: 2ntg A:1-164 [138579]
    automatically matched to d1jtma_
    complexed with bme, r7a; mutant

Details for d2ntga1

PDB Entry: 2ntg (more details), 1.4 Å

PDB Description: structure of spin-labeled t4 lysozyme mutant t115r7
PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d2ntga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntga1 d.2.1.3 (A:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d2ntga1:

Click to download the PDB-style file with coordinates for d2ntga1.
(The format of our PDB-style files is described here.)

Timeline for d2ntga1: