SCOP 1.73: Domain d2ntga1: 2ntg A:1-164

Lineage for d2ntga1 (2ntg A:1-164)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (431 PDB entries)
   many mutant structures

8. Domain d2ntga1: 2ntg A:1-164 [138579]
   automatically matched to d1jtma_
   complexed with bme, r7a; mutant

Details for d2ntga1

PDB Entry: 2ntg, 1.4 Å

PDB Description: structure of spin-labeled t4 lysozyme mutant t115r7

PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d2ntga1:

Sequence; same for both SEQRES and ATOM records:

>d2ntga1 d.2.1.3 (A:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d2ntga1:

• d2ntga1 is new in SCOP 1.73
  
• d2ntga1 appears in SCOP 1.75
  
• d2ntga1 appears in the current release, SCOPe 2.08, called d2ntga_