SCOPe 2.01: Domain d2ntca_: 2ntc A:

Lineage for d2ntca_ (2ntc A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)

6. Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)

7. Species Simian virus 40, Sv40 [TaxId:10633] [55467] (11 PDB entries)

8. Domain d2ntca_: 2ntc A: [138577]
   automated match to d1tbd__
   protein/DNA complex

Details for d2ntca_

PDB Entry: 2ntc, 2.4 Å

PDB Description: Crystal Structure of sv40 large T antigen origin binding domain with DNA

PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d2ntca_:

Sequence; same for both SEQRES and ATOM records:

>d2ntca_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
vedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsyn
hnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpgg
lkehdfn

Timeline for d2ntca_:

• d2ntca_ first appeared in SCOP 1.73, called d2ntca1
  
• d2ntca_ was called d2ntca1 in SCOP 1.75
  
• d2ntca_ appears in SCOPe 2.02
  
• d2ntca_ appears in the current release, SCOPe 2.08