Lineage for d2ntca_ (2ntc A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. Species Simian virus 40, Sv40 [TaxId:10633] [55467] (10 PDB entries)
  8. Domain d2ntca_: 2ntc A: [138577]
    automated match to d1tbd__
    protein/DNA complex

Details for d2ntca_

PDB Entry: 2ntc (more details), 2.4 Å

PDB Description: Crystal Structure of sv40 large T antigen origin binding domain with DNA
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d2ntca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntca_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
vedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsyn
hnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpgg
lkehdfn

SCOPe Domain Coordinates for d2ntca_ are not available.

Timeline for d2ntca_:

Domains from other chains:
(mouse over for more information)
d2ntcb_