SCOP 1.75: Domain d2nt1b2: 2nt1 B:78-431

Lineage for d2nt1b2 (2nt1 B:78-431)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (26 proteins)
   consist of a number of sequence families

6. Protein Glucosylceramidase, catalytic domain [89473] (1 species)
   acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases

7. Species Human (Homo sapiens) [TaxId:9606] [89474] (11 PDB entries)

8. Domain d2nt1b2: 2nt1 B:78-431 [138572]
   Other proteins in same PDB: d2nt1a1, d2nt1b1, d2nt1c1, d2nt1d1
   automatically matched to d1ogsa2
   complexed with nag, po4

Details for d2nt1b2

PDB Entry: 2nt1, 2.3 Å

PDB Description: structure of acid-beta-glucosidase at neutral ph

PDB Compounds: (B:) glucosylceramidase

SCOP Domain Sequences for d2nt1b2:

Sequence; same for both SEQRES and ATOM records:

>d2nt1b2 c.1.8.3 (B:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad
tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl
kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr
dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl
apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg
wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs

Timeline for d2nt1b2:

• d2nt1b2 first appeared in SCOP 1.73
  
• d2nt1b2 appears in SCOPe 2.01
  
• d2nt1b2 appears in the current release, SCOPe 2.08