Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Glucosylceramidase, catalytic domain [89473] (1 species) acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases |
Species Human (Homo sapiens) [TaxId:9606] [89474] (23 PDB entries) |
Domain d2nsxa2: 2nsx A:78-431 [138553] Other proteins in same PDB: d2nsxa1, d2nsxb1, d2nsxc1, d2nsxd1 automated match to d1ogsa2 complexed with gol, ifm, nag, so4 |
PDB Entry: 2nsx (more details), 2.11 Å
SCOPe Domain Sequences for d2nsxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nsxa2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs
Timeline for d2nsxa2: