SCOP 1.75: Domain d2nsub3: 2nsu B:122-189,B:383-608

Lineage for d2nsub3 (2nsu B:122-189,B:383-608)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)

6. Protein Transferrin receptor ectodomain, protease-like domain [53211] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53212] (3 PDB entries)

8. Domain d2nsub3: 2nsu B:122-189,B:383-608 [138551]
   Other proteins in same PDB: d2nsua1, d2nsua2, d2nsub1, d2nsub2
   automatically matched to d1cx8a3

Details for d2nsub3

PDB Entry: 2nsu, 27 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor fitted into a cryo-em reconstruction of canine parvovirus and feline transferrin receptor complex

PDB Compounds: (B:) Transferrin receptor protein 1

SCOP Domain Sequences for d2nsub3:

Sequence; same for both SEQRES and ATOM records:

>d2nsub3 c.56.5.5 (B:122-189,B:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]}
lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
wrdqhfvkXeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgvgtalllklaqmf
sdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaftyinldkavlgtsn
fkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaafpflaysgipav
sfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfviklthdveln

Timeline for d2nsub3:

• d2nsub3 first appeared in SCOP 1.73
  
• d2nsub3 appears in SCOPe 2.01
  
• d2nsub3 appears in the current release, SCOPe 2.08