SCOP 1.75: Domain d2nsub2: 2nsu B:190-382

Lineage for d2nsub2 (2nsu B:190-382)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.4: PA domain [52025] (1 family)

5. Family c.8.4.1: PA domain [52026] (2 proteins)

6. Protein Transferrin receptor ectodomain, apical domain [52027] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52028] (3 PDB entries)

8. Domain d2nsub2: 2nsu B:190-382 [138550]
   Other proteins in same PDB: d2nsua1, d2nsua3, d2nsub1, d2nsub3
   automatically matched to d1cx8a2

Details for d2nsub2

PDB Entry: 2nsu, 27 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor fitted into a cryo-em reconstruction of canine parvovirus and feline transferrin receptor complex

PDB Compounds: (B:) Transferrin receptor protein 1

SCOP Domain Sequences for d2nsub2:

Sequence; same for both SEQRES and ATOM records:

>d2nsub2 c.8.4.1 (B:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]}
iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp
vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy
tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse
sknvkltvsnvlk

Timeline for d2nsub2:

• d2nsub2 first appeared in SCOP 1.73
  
• d2nsub2 appears in SCOPe 2.01
  
• d2nsub2 appears in the current release, SCOPe 2.08