Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.4: PA domain [52025] (1 family) |
Family c.8.4.1: PA domain [52026] (2 proteins) |
Protein Transferrin receptor ectodomain, apical domain [52027] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52028] (4 PDB entries) |
Domain d2nsua2: 2nsu A:190-382 [138547] Other proteins in same PDB: d2nsua1, d2nsua3, d2nsub1, d2nsub3 automatically matched to d1cx8a2 |
PDB Entry: 2nsu (more details), 27 Å
SCOPe Domain Sequences for d2nsua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nsua2 c.8.4.1 (A:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} iqvkdsaqnsviivdkngrlvylvenpggyvayskaatvtgklvhanfgtkkdfedlytp vngsivivragkitfaekvanaeslnaigvliymdqtkfpivnaelsffghahlgtgdpy tpgfpsfnhtqfppsrssglpnipvqtisraaaeklfgnmegdcpsdwktdstcrmvtse sknvkltvsnvlk
Timeline for d2nsua2: