Lineage for d2nsua1 (2nsu A:609-760)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714566Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2714598Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 2714599Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 2714639Protein Transferrin receptor ectodomain, C-terminal domain [47674] (1 species)
  7. 2714640Species Human (Homo sapiens) [TaxId:9606] [47675] (4 PDB entries)
  8. 2714653Domain d2nsua1: 2nsu A:609-760 [138546]
    Other proteins in same PDB: d2nsua2, d2nsua3, d2nsub2, d2nsub3
    automatically matched to d1cx8a1

Details for d2nsua1

PDB Entry: 2nsu (more details), 27 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor fitted into a cryo-em reconstruction of canine parvovirus and feline transferrin receptor complex
PDB Compounds: (A:) Transferrin receptor protein 1

SCOPe Domain Sequences for d2nsua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nsua1 a.48.2.1 (A:609-760) Transferrin receptor ectodomain, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ldyeeynsqllsfvrdlnqyradikemglslqwlysargdffratsrlttdfgnaektdr
fvmkklndrvmrveyhflspyvspkespfrhvfwgsgshtlpallenlklrkqnngafne
tlfrnqlalatwtiqgaanalsgdvwdidnef

SCOPe Domain Coordinates for d2nsua1:

Click to download the PDB-style file with coordinates for d2nsua1.
(The format of our PDB-style files is described here.)

Timeline for d2nsua1: