SCOPe 2.08: Domain d2ns1a_: 2ns1 A:

Lineage for d2ns1a_ (2ns1 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.44: Ammonium transporter [111351] (1 superfamily)
   11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix

4. Superfamily f.44.1: Ammonium transporter [111352] (2 families)
   automatically mapped to Pfam PF00909

5. Family f.44.1.0: automated matches [227165] (1 protein)
   not a true family

6. Protein automated matches [226873] (5 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255512] (2 PDB entries)

8. Domain d2ns1a_: 2ns1 A: [138545]
   Other proteins in same PDB: d2ns1b1, d2ns1b2
   automated match to d2b2ha_
   complexed with adp, bog, trs

Details for d2ns1a_

PDB Entry: 2ns1, 1.96 Å

PDB Description: crystal structure of the e. coli ammonia channel amtb complexed with the signal transduction protein glnk

PDB Compounds: (A:) Ammonia channel

SCOPe Domain Sequences for d2ns1a_:

Sequence; same for both SEQRES and ATOM records:

>d2ns1a_ f.44.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai
lgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml
krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait
ivwsgvvafigykladltvglrvpeeqeregldvnshgenayna

Timeline for d2ns1a_:

• d2ns1a_ first appeared in SCOP 1.73, called d2ns1a1
  
• d2ns1a_ appears in SCOPe 2.07