![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
![]() | Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() automatically mapped to Pfam PF03453 |
![]() | Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
![]() | Domain d2nrsb2: 2nrs B:7-177 [138543] Other proteins in same PDB: d2nrsa1, d2nrsa3, d2nrsb1, d2nrsb3 automated match to d1g8la2 |
PDB Entry: 2nrs (more details), 2.8 Å
SCOPe Domain Sequences for d2nrsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nrsb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d2nrsb2: