Lineage for d2nrsb2 (2nrs B:7-177)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820794Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2820795Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2820796Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2820804Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 2820805Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 2820833Domain d2nrsb2: 2nrs B:7-177 [138543]
    Other proteins in same PDB: d2nrsa1, d2nrsa3, d2nrsb1, d2nrsb3
    automated match to d1g8la2

Details for d2nrsb2

PDB Entry: 2nrs (more details), 2.8 Å

PDB Description: moea s371w
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrsb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOPe Domain Coordinates for d2nrsb2:

Click to download the PDB-style file with coordinates for d2nrsb2.
(The format of our PDB-style files is described here.)

Timeline for d2nrsb2: