SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2nrsb1 (2nrs B:327-409)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2072967Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2072968Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 protein domains)
  6. 2072976Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 2072977Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 2073005Domain d2nrsb1: 2nrs B:327-409 [138542]
    Other proteins in same PDB: d2nrsa2, d2nrsa3, d2nrsb2, d2nrsb3
    automated match to d1g8la1

Details for d2nrsb1

PDB Entry: 2nrs (more details), 2.8 Å

PDB Description: MoeA S371W
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrsb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgwhifssfslgncfivl
erdrgnvevgewvevepfnalfg

SCOPe Domain Coordinates for d2nrsb1:

Click to download the PDB-style file with coordinates for d2nrsb1.
(The format of our PDB-style files is described here.)

Timeline for d2nrsb1: