Lineage for d2nrsa3 (2nrs A:178-326)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1174345Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 1174346Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 1174427Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
  6. 1174435Protein MoeA, central domain [64104] (4 species)
  7. 1174436Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)
  8. 1174463Domain d2nrsa3: 2nrs A:178-326 [138541]
    Other proteins in same PDB: d2nrsa1, d2nrsa2, d2nrsb1, d2nrsb2
    automatically matched to d1fc5a3

Details for d2nrsa3

PDB Entry: 2nrs (more details), 2.8 Å

PDB Description: moea s371w
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrsa3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

SCOPe Domain Coordinates for d2nrsa3:

Click to download the PDB-style file with coordinates for d2nrsa3.
(The format of our PDB-style files is described here.)

Timeline for d2nrsa3: