Lineage for d2nrsa2 (2nrs A:7-177)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430092Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2430093Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2430094Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2430102Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 2430103Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 2430130Domain d2nrsa2: 2nrs A:7-177 [138540]
    Other proteins in same PDB: d2nrsa1, d2nrsa3, d2nrsb1, d2nrsb3
    automated match to d1g8la2

Details for d2nrsa2

PDB Entry: 2nrs (more details), 2.8 Å

PDB Description: moea s371w
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrsa2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOPe Domain Coordinates for d2nrsa2:

Click to download the PDB-style file with coordinates for d2nrsa2.
(The format of our PDB-style files is described here.)

Timeline for d2nrsa2: