![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.2: MoeA central domain-like [64103] (2 proteins) |
![]() | Protein MoeA, central domain [64104] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [64105] (14 PDB entries) |
![]() | Domain d2nrpb3: 2nrp B:178-326 [138538] Other proteins in same PDB: d2nrpa1, d2nrpa2, d2nrpb1, d2nrpb2 automatically matched to d1fc5a3 complexed with gol |
PDB Entry: 2nrp (more details), 3 Å
SCOPe Domain Sequences for d2nrpb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nrpb3 c.57.1.2 (B:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]} vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl pgnpvsatltfyqlvqpllaklsgntasg
Timeline for d2nrpb3: