SCOP 1.75: Domain d2nrpb2: 2nrp B:7-177

Lineage for d2nrpb2 (2nrp B:7-177)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)

7. Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)

8. Domain d2nrpb2: 2nrp B:7-177 [138537]
   Other proteins in same PDB: d2nrpa1, d2nrpa3, d2nrpb1, d2nrpb3
   automatically matched to d1fc5a2
   complexed with gol; mutant

Details for d2nrpb2

PDB Entry: 2nrp, 3 Å

PDB Description: moea r350a

PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nrpb2:

Sequence; same for both SEQRES and ATOM records:

>d2nrpb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

Timeline for d2nrpb2:

• d2nrpb2 first appeared in SCOP 1.73
  
• d2nrpb2 appears in SCOPe 2.01
  
• d2nrpb2 appears in the current release, SCOPe 2.08