Lineage for d2nrpb2 (2nrp B:7-177)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811992Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 811993Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 811994Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 812002Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 812005Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 812029Domain d2nrpb2: 2nrp B:7-177 [138537]
    Other proteins in same PDB: d2nrpa1, d2nrpa3, d2nrpb1, d2nrpb3
    automatically matched to d1fc5a2
    complexed with gol; mutant

Details for d2nrpb2

PDB Entry: 2nrp (more details), 3 Å

PDB Description: moea r350a
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nrpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrpb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOP Domain Coordinates for d2nrpb2:

Click to download the PDB-style file with coordinates for d2nrpb2.
(The format of our PDB-style files is described here.)

Timeline for d2nrpb2: