Lineage for d2nrpb1 (2nrp B:327-411)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427879Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2427880Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 2427888Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 2427889Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 2427913Domain d2nrpb1: 2nrp B:327-411 [138536]
    Other proteins in same PDB: d2nrpa2, d2nrpa3, d2nrpb2, d2nrpb3
    automated match to d1g8la1
    complexed with gol

Details for d2nrpb1

PDB Entry: 2nrp (more details), 3 Å

PDB Description: moea r350a
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrpb1 b.85.6.1 (B:327-411) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqagvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfggl

SCOPe Domain Coordinates for d2nrpb1:

Click to download the PDB-style file with coordinates for d2nrpb1.
(The format of our PDB-style files is described here.)

Timeline for d2nrpb1: