SCOPe 2.05: Domain d2nrpb1: 2nrp B:327-411

Lineage for d2nrpb1 (2nrp B:327-411)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)

7. Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)

8. Domain d2nrpb1: 2nrp B:327-411 [138536]
   Other proteins in same PDB: d2nrpa2, d2nrpa3, d2nrpb2, d2nrpb3
   automated match to d1g8la1
   complexed with gol

Details for d2nrpb1

PDB Entry: 2nrp, 3 Å

PDB Description: moea r350a

PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrpb1:

Sequence; same for both SEQRES and ATOM records:

>d2nrpb1 b.85.6.1 (B:327-411) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqagvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfggl

Timeline for d2nrpb1:

• d2nrpb1 first appeared in SCOP 1.73
  
• d2nrpb1 appears in SCOPe 2.04
  
• d2nrpb1 appears in SCOPe 2.06
  
• d2nrpb1 appears in the current release, SCOPe 2.08