Lineage for d2nrpa2 (2nrp A:7-177)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965624Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 965625Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 965626Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 965634Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 965635Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 965658Domain d2nrpa2: 2nrp A:7-177 [138534]
    Other proteins in same PDB: d2nrpa1, d2nrpa3, d2nrpb1, d2nrpb3
    automatically matched to d1fc5a2
    complexed with gol

Details for d2nrpa2

PDB Entry: 2nrp (more details), 3 Å

PDB Description: moea r350a
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrpa2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOPe Domain Coordinates for d2nrpa2:

Click to download the PDB-style file with coordinates for d2nrpa2.
(The format of our PDB-style files is described here.)

Timeline for d2nrpa2: