Lineage for d2nrob2 (2nro B:7-177)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679239Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 679240Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 679241Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 679249Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 679252Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 679272Domain d2nrob2: 2nro B:7-177 [138531]
    Other proteins in same PDB: d2nroa1, d2nroa3, d2nrob1, d2nrob3
    automatically matched to d1fc5a2
    mutant

Details for d2nrob2

PDB Entry: 2nro (more details), 2.5 Å

PDB Description: MoeA K279Q
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nrob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrob2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOP Domain Coordinates for d2nrob2:

Click to download the PDB-style file with coordinates for d2nrob2.
(The format of our PDB-style files is described here.)

Timeline for d2nrob2: