SCOPe 2.08: Domain d2nrob2: 2nro B:7-177

Lineage for d2nrob2 (2nro B:7-177)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)
   automatically mapped to Pfam PF03453

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)

7. Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)

8. Domain d2nrob2: 2nro B:7-177 [138531]
   Other proteins in same PDB: d2nroa1, d2nroa3, d2nrob1, d2nrob3
   automated match to d1g8la2

Details for d2nrob2

PDB Entry: 2nro, 2.5 Å

PDB Description: moea k279q

PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nrob2:

Sequence; same for both SEQRES and ATOM records:

>d2nrob2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

Timeline for d2nrob2:

• d2nrob2 first appeared in SCOP 1.73
  
• d2nrob2 appears in SCOPe 2.07