SCOP 1.73: Domain d2nroa3: 2nro A:178-326

Lineage for d2nroa3 (2nro A:178-326)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)

6. Protein MoeA, central domain [64104] (4 species)

7. Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)

8. Domain d2nroa3: 2nro A:178-326 [138529]
   Other proteins in same PDB: d2nroa1, d2nroa2, d2nrob1, d2nrob2
   automatically matched to d1fc5a3
   mutant

Details for d2nroa3

PDB Entry: 2nro, 2.5 Å

PDB Description: moea k279q

PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nroa3:

Sequence; same for both SEQRES and ATOM records:

>d2nroa3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaiqpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

Timeline for d2nroa3:

• d2nroa3 is new in SCOP 1.73
  
• d2nroa3 appears in SCOP 1.75
  
• d2nroa3 appears in the current release, SCOPe 2.08