Lineage for d2nroa1 (2nro A:327-409)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811267Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 811268Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 811276Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 811279Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 811292Domain d2nroa1: 2nro A:327-409 [138527]
    Other proteins in same PDB: d2nroa2, d2nroa3, d2nrob2, d2nrob3
    automatically matched to d1g8la1
    mutant

Details for d2nroa1

PDB Entry: 2nro (more details), 2.5 Å

PDB Description: moea k279q
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nroa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nroa1 b.85.6.1 (A:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

SCOP Domain Coordinates for d2nroa1:

Click to download the PDB-style file with coordinates for d2nroa1.
(The format of our PDB-style files is described here.)

Timeline for d2nroa1: