Lineage for d2nrhb2 (2nrh B:83-207)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884670Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 2884671Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 2884672Species Campylobacter jejuni [TaxId:197] [142488] (1 PDB entry)
    Uniprot Q5HW73 1-82! Uniprot Q5HW73 83-208
  8. 2884676Domain d2nrhb2: 2nrh B:83-207 [138526]
    Other proteins in same PDB: d2nrha3, d2nrhb3
    automated match to d2nrha2
    complexed with so4

Details for d2nrhb2

PDB Entry: 2nrh (more details), 2.3 Å

PDB Description: crystal structure of conserved putative baf family transcriptional activator from campylobacter jejuni
PDB Compounds: (B:) Transcriptional activator, putative, Baf family

SCOPe Domain Sequences for d2nrhb2:

Sequence, based on SEQRES records: (download)

>d2nrhb2 c.55.1.13 (B:83-207) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}
edgvvvdagsaitidiisnsihlggfilpgianykkiyshisprlksefntqvsldafpq
ktmdalsygvfkgiyllikdaaqnkklyftggdgqflanyfdhaiydkllifrgmkkiik
enpnl

Sequence, based on observed residues (ATOM records): (download)

>d2nrhb2 c.55.1.13 (B:83-207) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}
edgvvvdagsaitidiisnsihlggfilpgianykkiyshisprlfntqvsldafpqktm
dalsygvfkgiyllikdaakklyftggdgqflanyfdhaiydkllifrgmkkiikenpnl

SCOPe Domain Coordinates for d2nrhb2:

Click to download the PDB-style file with coordinates for d2nrhb2.
(The format of our PDB-style files is described here.)

Timeline for d2nrhb2: