SCOP 1.73: Domain d2nrha1: 2nrh A:1-82

Lineage for d2nrha1 (2nrh A:1-82)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.13: CoaX-like [142484] (1 protein)
   Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf

6. Protein Type III pantothenate kinase, CoaX [142485] (3 species)

7. Species Campylobacter jejuni [TaxId:197] [142488] (1 PDB entry)

8. Domain d2nrha1: 2nrh A:1-82 [138523]
   complexed with so4; mutant

Details for d2nrha1

PDB Entry: 2nrh, 2.3 Å

PDB Description: crystal structure of conserved putative baf family transcriptional activator from campylobacter jejuni

PDB Compounds: (A:) Transcriptional activator, putative, Baf family

SCOP Domain Sequences for d2nrha1:

Sequence, based on SEQRES records:

>d2nrha1 c.55.1.13 (A:1-82) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}
lllcdignsnanflddnkyftlnidqflefkneqkifyinvnehlkehlknqknfinlep
yflfdtiyqglgidriaacyti

Sequence, based on observed residues (ATOM records):

>d2nrha1 c.55.1.13 (A:1-82) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}
lllcdignsnanfldkyftlnidqflefifyinvnehlkehlknqknfinlepyflfdti
yqglgidriaacyti

Timeline for d2nrha1:

• d2nrha1 is new in SCOP 1.73
  
• d2nrha1 appears in SCOP 1.75
  
• d2nrha1 appears in the current release, SCOPe 2.08