Lineage for d2nrfa_ (2nrf A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028691Fold f.51: Rhomboid-like [144090] (1 superfamily)
    6 transmembrane helices
  4. 3028692Superfamily f.51.1: Rhomboid-like [144091] (2 families) (S)
  5. 3028693Family f.51.1.1: Rhomboid-like [144092] (3 proteins)
    Pfam PF01694; transmembrane serine protease
  6. 3028694Protein GlpG [144095] (1 species)
  7. 3028695Species Escherichia coli [TaxId:562] [144096] (19 PDB entries)
    Uniprot P09391 91-272
  8. 3028715Domain d2nrfa_: 2nrf A: [138521]
    automated match to d2ic8a1

Details for d2nrfa_

PDB Entry: 2nrf (more details), 2.6 Å

PDB Description: crystal structure of glpg, a rhomboid family intramembrane protease
PDB Compounds: (A:) Protein glpG

SCOPe Domain Sequences for d2nrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrfa_ f.51.1.1 (A:) GlpG {Escherichia coli [TaxId: 562]}
eragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmh
ilfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgy
vwlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsl
na

SCOPe Domain Coordinates for d2nrfa_:

Click to download the PDB-style file with coordinates for d2nrfa_.
(The format of our PDB-style files is described here.)

Timeline for d2nrfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nrfb_