Lineage for d2nrea1 (2nre A:7-270)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565614Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2565615Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 2565616Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)
  6. 2565617Protein Pseudouridine synthase I TruA [55122] (1 species)
  7. 2565618Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)
  8. 2565629Domain d2nrea1: 2nre A:7-270 [138520]
    automatically matched to d1dj0a_
    protein/RNA complex; complexed with k

Details for d2nrea1

PDB Entry: 2nre (more details), 4 Å

PDB Description: Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA
PDB Compounds: (A:) tRNA pseudouridine synthase A

SCOPe Domain Sequences for d2nrea1:

Sequence, based on SEQRES records: (download)

>d2nrea1 d.265.1.1 (A:7-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

Sequence, based on observed residues (ATOM records): (download)

>d2nrea1 d.265.1.1 (A:7-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravtpwrnvmhinvtrhgpyvv
vdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaeglylvavd
ypdrydlpkppmgplflad

SCOPe Domain Coordinates for d2nrea1:

Click to download the PDB-style file with coordinates for d2nrea1.
(The format of our PDB-style files is described here.)

Timeline for d2nrea1: