Lineage for d2nr0c1 (2nr0 C:7-270)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615008Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2615009Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 2615010Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)
  6. 2615011Protein Pseudouridine synthase I TruA [55122] (1 species)
  7. 2615012Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)
  8. 2615021Domain d2nr0c1: 2nr0 C:7-270 [138516]
    automatically matched to d1dj0a_
    protein/RNA complex

Details for d2nr0c1

PDB Entry: 2nr0 (more details), 3.9 Å

PDB Description: Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA
PDB Compounds: (C:) tRNA pseudouridine synthase A

SCOPe Domain Sequences for d2nr0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nr0c1 d.265.1.1 (C:7-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

SCOPe Domain Coordinates for d2nr0c1:

Click to download the PDB-style file with coordinates for d2nr0c1.
(The format of our PDB-style files is described here.)

Timeline for d2nr0c1: