Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) the active site is the most conserved structural region of the superfamily and is located between the subdomains |
Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein) |
Protein Pseudouridine synthase I TruA [55122] (1 species) |
Species Escherichia coli [TaxId:562] [55123] (4 PDB entries) |
Domain d2nr0c1: 2nr0 C:7-270 [138516] automatically matched to d1dj0a_ protein/RNA complex |
PDB Entry: 2nr0 (more details), 3.9 Å
SCOPe Domain Sequences for d2nr0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nr0c1 d.265.1.1 (C:7-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]} ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly lvavdypdrydlpkppmgplflad
Timeline for d2nr0c1: