SCOPe 2.08: Domain d2nr0b1: 2nr0 B:7-270

Lineage for d2nr0b1 (2nr0 B:7-270)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)

6. Protein Pseudouridine synthase I TruA [55122] (1 species)

7. Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)

8. Domain d2nr0b1: 2nr0 B:7-270 [138515]
   automatically matched to d1dj0a_
   protein/RNA complex

Details for d2nr0b1

PDB Entry: 2nr0, 3.9 Å

PDB Description: Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA

PDB Compounds: (B:) tRNA pseudouridine synthase A

SCOPe Domain Sequences for d2nr0b1:

Sequence; same for both SEQRES and ATOM records:

>d2nr0b1 d.265.1.1 (B:7-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

Timeline for d2nr0b1:

• d2nr0b1 first appeared in SCOP 1.73
  
• d2nr0b1 appears in SCOPe 2.07