![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) ![]() |
![]() | Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [63870] (14 PDB entries) |
![]() | Domain d2nqvb1: 2nqv B:327-409 [138511] Other proteins in same PDB: d2nqva2, d2nqva3, d2nqvb2, d2nqvb3 automatically matched to d1g8la1 complexed with gol; mutant |
PDB Entry: 2nqv (more details), 2.82 Å
SCOP Domain Sequences for d2nqvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqvb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]} lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl erdrgnvevgewvevepfnalfg
Timeline for d2nqvb1: