![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.2: MoeA central domain-like [64103] (2 proteins) automatically mapped to Pfam PF00994 |
![]() | Protein MoeA, central domain [64104] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [64105] (14 PDB entries) |
![]() | Domain d2nqua3: 2nqu A:178-326 [138504] Other proteins in same PDB: d2nqua1, d2nqua2, d2nqub1, d2nqub2 automated match to d1g8la3 complexed with gol |
PDB Entry: 2nqu (more details), 2.7 Å
SCOPe Domain Sequences for d2nqua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqua3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]} vrvalfstgdqlqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl pgnpvsatltfyqlvqpllaklsgntasg
Timeline for d2nqua3: