SCOPe 2.08: Domain d2nqua1: 2nqu A:327-409

Lineage for d2nqua1 (2nqu A:327-409)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)

7. Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)

8. Domain d2nqua1: 2nqu A:327-409 [138502]
   Other proteins in same PDB: d2nqua2, d2nqua3, d2nqub2, d2nqub3
   automated match to d1g8la1
   complexed with gol

Details for d2nqua1

PDB Entry: 2nqu, 2.7 Å

PDB Description: moea e188q

PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqua1:

Sequence; same for both SEQRES and ATOM records:

>d2nqua1 b.85.6.1 (A:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

Timeline for d2nqua1:

• d2nqua1 first appeared in SCOP 1.73
  
• d2nqua1 appears in SCOPe 2.07