Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) automatically mapped to Pfam PF03454 |
Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
Species Escherichia coli [TaxId:562] [63870] (14 PDB entries) |
Domain d2nqrb1: 2nqr B:327-409 [138493] Other proteins in same PDB: d2nqra2, d2nqra3, d2nqrb2, d2nqrb3 automated match to d2nqra1 complexed with gol |
PDB Entry: 2nqr (more details), 2.2 Å
SCOPe Domain Sequences for d2nqrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqrb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]} lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl erdrgnvevgewvevepfnalfg
Timeline for d2nqrb1: