Lineage for d2nqrb1 (2nqr B:327-409)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139948Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 1139949Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 1139957Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 1139958Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 1139960Domain d2nqrb1: 2nqr B:327-409 [138493]
    Other proteins in same PDB: d2nqra2, d2nqra3, d2nqrb2, d2nqrb3
    automatically matched to d1g8la1
    complexed with gol

Details for d2nqrb1

PDB Entry: 2nqr (more details), 2.2 Å

PDB Description: moea d142n
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqrb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

SCOPe Domain Coordinates for d2nqrb1:

Click to download the PDB-style file with coordinates for d2nqrb1.
(The format of our PDB-style files is described here.)

Timeline for d2nqrb1: