SCOPe 2.08: Domain d2nqra3: 2nqr A:178-326

Lineage for d2nqra3 (2nqr A:178-326)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
   automatically mapped to Pfam PF00994

6. Protein MoeA, central domain [64104] (4 species)

7. Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)

8. Domain d2nqra3: 2nqr A:178-326 [138492]
   Other proteins in same PDB: d2nqra1, d2nqra2, d2nqrb1, d2nqrb2
   automated match to d2nqra3
   complexed with gol

Details for d2nqra3

PDB Entry: 2nqr, 2.2 Å

PDB Description: moea d142n

PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqra3:

Sequence; same for both SEQRES and ATOM records:

>d2nqra3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

Timeline for d2nqra3:

• d2nqra3 first appeared in SCOP 1.73
  
• d2nqra3 appears in SCOPe 2.07