Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) |
Family c.57.1.2: MoeA central domain-like [64103] (2 proteins) automatically mapped to Pfam PF00994 |
Protein MoeA, central domain [64104] (4 species) |
Species Escherichia coli [TaxId:562] [64105] (14 PDB entries) |
Domain d2nqqd3: 2nqq D:178-326 [138489] Other proteins in same PDB: d2nqqa1, d2nqqa2, d2nqqb1, d2nqqb2, d2nqqc1, d2nqqc2, d2nqqd1, d2nqqd2 automated match to d2nqra3 complexed with gol |
PDB Entry: 2nqq (more details), 2.4 Å
SCOPe Domain Sequences for d2nqqd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqqd3 c.57.1.2 (D:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]} vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl pgnpvsatltfyqlvqpllaklsgntasg
Timeline for d2nqqd3: