Class b: All beta proteins [48724] (174 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) |
Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
Domain d2nqqc2: 2nqq C:7-177 [138485] Other proteins in same PDB: d2nqqa1, d2nqqa3, d2nqqb1, d2nqqb3, d2nqqc1, d2nqqc3, d2nqqd1, d2nqqd3 automatically matched to d1fc5a2 complexed with gol; mutant |
PDB Entry: 2nqq (more details), 2.4 Å
SCOP Domain Sequences for d2nqqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqqc2 b.103.1.1 (C:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf taevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d2nqqc2: