Lineage for d2nqqb1 (2nqq B:327-409)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818545Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2818546Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 2818554Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 2818555Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 2818563Domain d2nqqb1: 2nqq B:327-409 [138481]
    Other proteins in same PDB: d2nqqa2, d2nqqa3, d2nqqb2, d2nqqb3, d2nqqc2, d2nqqc3, d2nqqd2, d2nqqd3
    automated match to d2nqra1
    complexed with gol

Details for d2nqqb1

PDB Entry: 2nqq (more details), 2.4 Å

PDB Description: moea r137q
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqqb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

SCOPe Domain Coordinates for d2nqqb1:

Click to download the PDB-style file with coordinates for d2nqqb1.
(The format of our PDB-style files is described here.)

Timeline for d2nqqb1: