Lineage for d2nqqa3 (2nqq A:178-326)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2497903Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2497904Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2497998Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
    automatically mapped to Pfam PF00994
  6. 2498006Protein MoeA, central domain [64104] (4 species)
  7. 2498007Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)
  8. 2498014Domain d2nqqa3: 2nqq A:178-326 [138480]
    Other proteins in same PDB: d2nqqa1, d2nqqa2, d2nqqb1, d2nqqb2, d2nqqc1, d2nqqc2, d2nqqd1, d2nqqd2
    automated match to d2nqra3
    complexed with gol

Details for d2nqqa3

PDB Entry: 2nqq (more details), 2.4 Å

PDB Description: moea r137q
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqqa3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

SCOPe Domain Coordinates for d2nqqa3:

Click to download the PDB-style file with coordinates for d2nqqa3.
(The format of our PDB-style files is described here.)

Timeline for d2nqqa3: